Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein automated matches [190058] (11 species) not a true protein |
Species Peanut (Arachis hypogaea) [TaxId:3818] [397678] (5 PDB entries) |
Domain d6v8sa_: 6v8s A: [397862] automated match to d1ifva_ complexed with 2an, so4 |
PDB Entry: 6v8s (more details), 2.1 Å
SCOPe Domain Sequences for d6v8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v8sa_ d.129.3.1 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} gvhtfeeestspvppaklfkatvvdgdeltpklipaiqsieivegnggpgtvkkvtaved gktsyvlhkidaideatytydytisggtgfqeilekvsfktkleaadggskikvsvtfht kgdaplpdevhqdvkqksqgifkaiegyvlsn
Timeline for d6v8sa_: