Lineage for d6v8cc_ (6v8c C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896169Protein Ornithine aminotransferase [53422] (3 species)
  7. 2896170Species Human (Homo sapiens) [TaxId:9606] [53423] (11 PDB entries)
  8. 2896179Domain d6v8cc_: 6v8c C: [397815]
    automated match to d2byja1
    complexed with plp, qrm

Details for d6v8cc_

PDB Entry: 6v8c (more details), 1.9 Å

PDB Description: design, synthesis, and mechanism of fluorine-substituted cyclohexene analogues of gama-aminobutyric acid (gaba) as selective ornithine aminotransferase inactivators
PDB Compounds: (C:) Ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d6v8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v8cc_ c.67.1.4 (C:) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssysavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d6v8cc_:

Click to download the PDB-style file with coordinates for d6v8cc_.
(The format of our PDB-style files is described here.)

Timeline for d6v8cc_: