Lineage for d6vcub_ (6vcu B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548810Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)
  8. 2548833Domain d6vcub_: 6vcu B: [397800]
    automated match to d4c02b_
    complexed with act, r27

Details for d6vcub_

PDB Entry: 6vcu (more details), 1.69 Å

PDB Description: homo sapiens fkbp12 protein bound with apx879 in p32 space group
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6vcub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vcub_ d.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d6vcub_:

Click to download the PDB-style file with coordinates for d6vcub_.
(The format of our PDB-style files is described here.)

Timeline for d6vcub_: