SCOP 1.57: Domain d1comb_: 1com B:

Lineage for d1comb_ (1com B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)

4. Superfamily d.79.1: YjgF-like [55298] (2 families)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)

6. Protein Chorismate mutase [55305] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries)

8. Domain d1comb_: 1com B: [39779]

Details for d1comb_

PDB Entry: 1com, 2.2 Å

PDB Description: the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction

SCOP Domain Sequences for d1comb_:

Sequence; same for both SEQRES and ATOM records:

>d1comb_ d.79.1.2 (B:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpdl

Timeline for d1comb_:

• d1comb_ first appeared (with stable ids) in SCOP 1.55
  
• d1comb_ appears in SCOP 1.59
  
• d1comb_ appears in the current release, SCOPe 2.08