![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) |
![]() | Superfamily d.79.1: YjgF-like [55298] (2 families) ![]() |
![]() | Family d.79.1.2: Chorismate mutase [55304] (1 protein) |
![]() | Protein Chorismate mutase [55305] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries) |
![]() | Domain d1coma_: 1com A: [39778] |
PDB Entry: 1com (more details), 2.2 Å
SCOP Domain Sequences for d1coma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coma_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis} mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
Timeline for d1coma_: