Lineage for d1fnka_ (1fnk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914039Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914165Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 1914166Protein Chorismate mutase [55305] (3 species)
  7. 1914167Species Bacillus subtilis [TaxId:1423] [55306] (10 PDB entries)
  8. 1914201Domain d1fnka_: 1fnk A: [39777]
    mutant

Details for d1fnka_

PDB Entry: 1fnk (more details), 2 Å

PDB Description: crystal structure analysis of chorismate mutase mutant c88k/r90s
PDB Compounds: (A:) protein (chorismate mutase)

SCOPe Domain Sequences for d1fnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnka_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]}
mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
avrelsgwqyvpvtcmqemdvtgglkkkisvmmtvqtdvpqdqirhvylekavvlr

SCOPe Domain Coordinates for d1fnka_:

Click to download the PDB-style file with coordinates for d1fnka_.
(The format of our PDB-style files is described here.)

Timeline for d1fnka_: