![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (2 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.2: Chorismate mutase [55304] (1 protein) |
![]() | Protein Chorismate mutase [55305] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries) |
![]() | Domain d1fnka_: 1fnk A: [39777] mutant |
PDB Entry: 1fnk (more details), 2 Å
SCOP Domain Sequences for d1fnka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnka_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis} mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak avrelsgwqyvpvtamqemdvtgglkkkisvmmtvqtdvpqdqirhvylekavvlr
Timeline for d1fnka_: