Lineage for d6v8se_ (6v8s E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975603Species Peanut (Arachis hypogaea) [TaxId:3818] [397678] (5 PDB entries)
  8. 2975618Domain d6v8se_: 6v8s E: [397755]
    automated match to d1ifva_
    complexed with 2an, so4

Details for d6v8se_

PDB Entry: 6v8s (more details), 2.1 Å

PDB Description: crystal structure of ara h 8.0201
PDB Compounds: (E:) Ara h 8 allergen isoform

SCOPe Domain Sequences for d6v8se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v8se_ d.129.3.1 (E:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvhtfeeestspvppaklfkatvvdgdeltpklipaiqsieivegnggpgtvkkvtaved
gktsyvlhkidaideatytydytisggtgfqeilekvsfktkleaadggskikvsvtfht
kgdaplpdevhqdvkqksqgifkaiegyvlsn

SCOPe Domain Coordinates for d6v8se_:

Click to download the PDB-style file with coordinates for d6v8se_.
(The format of our PDB-style files is described here.)

Timeline for d6v8se_: