SCOPe 2.08: Domain d6vbta_: 6vbt A:

Lineage for d6vbta_ (6vbt A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (13 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [397733] (2 PDB entries)

8. Domain d6vbta_: 6vbt A: [397749]
   automated match to d1eqwb_
   complexed with cu, zn

Details for d6vbta_

PDB Entry: 6vbt, 1.7 Å

PDB Description: the p212121 crystal structure of sodci superoxide dismutase with 2 molecules in the asymmetric unit at 1.7 a resolution

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d6vbta_:

Sequence; same for both SEQRES and ATOM records:

>d6vbta_ b.1.8.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgviek

Timeline for d6vbta_:

• d6vbta_ first appeared in SCOPe 2.07