Lineage for d6vbse_ (6vbs E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764403Species Salmonella typhimurium [TaxId:90371] [397733] (2 PDB entries)
  8. 2764408Domain d6vbse_: 6vbs E: [397741]
    Other proteins in same PDB: d6vbsd2
    automated match to d1eqwb_
    complexed with cu, so4, zn

Details for d6vbse_

PDB Entry: 6vbs (more details), 1.7 Å

PDB Description: the c2 crystal form of sodci superoxide dismutase at 1.7 a resolution with 6 molecules in the asymmetric unit.
PDB Compounds: (E:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d6vbse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vbse_ b.1.8.1 (E:) automated matches {Salmonella typhimurium [TaxId: 90371]}
entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
elkghslmihkggdnysdkpaplggggarfacgvie

SCOPe Domain Coordinates for d6vbse_:

Click to download the PDB-style file with coordinates for d6vbse_.
(The format of our PDB-style files is described here.)

Timeline for d6vbse_: