SCOPe 2.08: Domain d6tmhf2: 6tmh F:153-436

Lineage for d6tmhf2 (6tmh F:153-436)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:507601] [397665] (1 PDB entry)

8. Domain d6tmhf2: 6tmh F:153-436 [397720]
   Other proteins in same PDB: d6tmha1, d6tmha2, d6tmha3, d6tmhb1, d6tmhb3, d6tmhc1, d6tmhc2, d6tmhc3, d6tmhd1, d6tmhd3, d6tmhe1, d6tmhe2, d6tmhe3, d6tmhf1, d6tmhf3, d6tmhg_
   automated match to d1mabb3
   complexed with adp, atp, mg

Details for d6tmhf2

PDB Entry: 6tmh, 3.1 Å

PDB Description: cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model

PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d6tmhf2:

Sequence; same for both SEQRES and ATOM records:

>d6tmhf2 c.37.1.0 (F:153-436) automated matches {Toxoplasma gondii [TaxId: 507601]}
iqvpvgvetlgrimnvigepvdecgpvpakktysihraaplfadqstepgllqtgikvvd
llapyakggkiglfggagvgktvlimelinnvankhggfsvfagvgertregndlyhemm
ttgvikrkkledgkfdftgskaalvygqmneppgararvaltalsvaeyfrdeqgqdvll
fidniyrftqagsevsallgripsavgyqptlatdlgqlqeritttkkgsitsvqavyvp
addltdpapattfahldattvlsrqiaelgiypavdpldstsrm

Timeline for d6tmhf2:

• d6tmhf2 first appeared in SCOPe 2.07