SCOPe 2.08: Domain d6tmhc3: 6tmh C:432-564

Lineage for d6tmhc3 (6tmh C:432-564)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:507601] [397667] (1 PDB entry)

8. Domain d6tmhc3: 6tmh C:432-564 [397697]
   Other proteins in same PDB: d6tmha1, d6tmha2, d6tmhb1, d6tmhb2, d6tmhc1, d6tmhc2, d6tmhd1, d6tmhd2, d6tmhe1, d6tmhe2, d6tmhf1, d6tmhf2, d6tmhg_
   automated match to d1maba1
   complexed with adp, atp, mg

Details for d6tmhc3

PDB Entry: 6tmh, 3.1 Å

PDB Description: cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model

PDB Compounds: (C:) ATP synthase subunit alpha,subunit alpha

SCOPe Domain Sequences for d6tmhc3:

Sequence; same for both SEQRES and ATOM records:

>d6tmhc3 a.69.1.0 (C:432-564) automated matches {Toxoplasma gondii [TaxId: 507601]}
vkamkqvagtmklelaqyrevaafaqfgsdldastrqlltrgtaltellkqrqyspmkns
vqvcvlycgvkgyldpldpkeisrfeslfidyinanhqdilktietekelsekteaklra
avdefvamnefkk

Timeline for d6tmhc3:

• d6tmhc3 first appeared in SCOPe 2.07