Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Toxoplasma gondii [TaxId:507601] [397667] (1 PDB entry) |
Domain d6tmhc3: 6tmh C:432-564 [397697] Other proteins in same PDB: d6tmha1, d6tmha2, d6tmhb1, d6tmhb2, d6tmhc1, d6tmhc2, d6tmhd1, d6tmhd2, d6tmhe1, d6tmhe2, d6tmhf1, d6tmhf2, d6tmhg_ automated match to d1maba1 complexed with adp, atp, mg |
PDB Entry: 6tmh (more details), 3.1 Å
SCOPe Domain Sequences for d6tmhc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tmhc3 a.69.1.0 (C:432-564) automated matches {Toxoplasma gondii [TaxId: 507601]} vkamkqvagtmklelaqyrevaafaqfgsdldastrqlltrgtaltellkqrqyspmkns vqvcvlycgvkgyldpldpkeisrfeslfidyinanhqdilktietekelsekteaklra avdefvamnefkk
Timeline for d6tmhc3: