Lineage for d2chsa_ (2chs A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506462Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 506510Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 506511Protein Chorismate mutase [55305] (2 species)
  7. 506512Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries)
  8. 506517Domain d2chsa_: 2chs A: [39764]

Details for d2chsa_

PDB Entry: 2chs (more details), 1.9 Å

PDB Description: crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog

SCOP Domain Sequences for d2chsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chsa_ d.79.1.2 (A:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl

SCOP Domain Coordinates for d2chsa_:

Click to download the PDB-style file with coordinates for d2chsa_.
(The format of our PDB-style files is described here.)

Timeline for d2chsa_: