Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (46 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [397633] (1 PDB entry) |
Domain d6tk9d_: 6tk9 D: [397634] automated match to d4earb_ complexed with po4 |
PDB Entry: 6tk9 (more details), 2.5 Å
SCOPe Domain Sequences for d6tk9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tk9d_ c.56.2.0 (D:) automated matches {Thermus thermophilus [TaxId: 274]} elydkiqeavayvrsktdfvpevglvlgsglgpladevekvaeipygeiphfpvstapgh agrlvlgrlegkpvlvykgrvhyyegysaeevvfpvrvgfflgartflltsaagglnprf raggimlhldyinfaganplrgpnderlgprfpvmfeaydpelielarkvarrqdlhlfe gvyawfmgpsfasraelrllrelgadaigmstvpevialrhlgarvlglstitdmavper ehhateeevlrvaaetgpvfrryvrgilael
Timeline for d6tk9d_: