SCOP 1.73: Domain d1qd9c_: 1qd9 C:

Lineage for d1qd9c_ (1qd9 C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Purine regulatory protein YabJ [55302] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [55303] (1 PDB entry)

8. Domain d1qd9c_: 1qd9 C: [39760]

Details for d1qd9c_

PDB Entry: 1qd9, 1.7 Å

PDB Description: Bacillus subtilis YABJ

PDB Compounds: (C:) purine regulatory protein yabj

SCOP Domain Sequences for d1qd9c_:

Sequence; same for both SEQRES and ATOM records:

>d1qd9c_ d.79.1.1 (C:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]}
tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
alvk

Timeline for d1qd9c_:

• d1qd9c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qd9c_ appears in SCOP 1.71
  
• d1qd9c_ appears in SCOP 1.75
  
• d1qd9c_ appears in the current release, SCOPe 2.08