Lineage for d1qd9b_ (1qd9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958685Protein Purine regulatory protein YabJ [55302] (2 species)
  7. 2958686Species Bacillus subtilis [TaxId:1423] [55303] (1 PDB entry)
  8. 2958688Domain d1qd9b_: 1qd9 B: [39759]
    complexed with acy, emc, hg

Details for d1qd9b_

PDB Entry: 1qd9 (more details), 1.7 Å

PDB Description: Bacillus subtilis YABJ
PDB Compounds: (B:) purine regulatory protein yabj

SCOPe Domain Sequences for d1qd9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd9b_ d.79.1.1 (B:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]}
tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
alvk

SCOPe Domain Coordinates for d1qd9b_:

Click to download the PDB-style file with coordinates for d1qd9b_.
(The format of our PDB-style files is described here.)

Timeline for d1qd9b_: