Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Purine regulatory protein YabJ [55302] (2 species) |
Species Bacillus subtilis [TaxId:1423] [55303] (1 PDB entry) |
Domain d1qd9b_: 1qd9 B: [39759] complexed with acy, emc, hg |
PDB Entry: 1qd9 (more details), 1.7 Å
SCOPe Domain Sequences for d1qd9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qd9b_ d.79.1.1 (B:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi alvk
Timeline for d1qd9b_: