Lineage for d1dzfa2 (1dzf A:144-215)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33601Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
  4. 33602Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 33603Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 33604Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 33605Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (1 PDB entry)
  8. 33606Domain d1dzfa2: 1dzf A:144-215 [39753]
    Other proteins in same PDB: d1dzfa1

Details for d1dzfa2

PDB Entry: 1dzf (more details), 1.9 Å

PDB Description: RPB5 from S.cerevisiae

SCOP Domain Sequences for d1dzfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzfa2 d.78.1.1 (A:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d1dzfa2:

Click to download the PDB-style file with coordinates for d1dzfa2.
(The format of our PDB-style files is described here.)

Timeline for d1dzfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dzfa1