Lineage for d1ffkd_ (1ffk D:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258857Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 258858Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 258859Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 258860Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 258861Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (8 PDB entries)
  8. 258865Domain d1ffkd_: 1ffk D: [39750]
    Other proteins in same PDB: d1ffkb_, d1ffky_
    complexed with cd, k, mo3; mutant

Details for d1ffkd_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkd_:

Sequence, based on SEQRES records: (download)

>d1ffkd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1ffkd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1ffkd_:

Click to download the PDB-style file with coordinates for d1ffkd_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkd_: