Lineage for d1ffkd_ (1ffk D:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193580Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
  4. 193581Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 193582Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 193583Protein Ribosomal protein L5 [55284] (2 species)
  7. 193584Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (7 PDB entries)
  8. 193587Domain d1ffkd_: 1ffk D: [39750]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkd_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkd_:

Sequence, based on SEQRES records: (download)

>d1ffkd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1ffkd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1ffkd_:

Click to download the PDB-style file with coordinates for d1ffkd_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkd_: