Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) |
Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
Protein DNA repair protein MutS, domain I [55273] (2 species) |
Species Escherichia coli [TaxId:562] [55275] (6 PDB entries) |
Domain d1e3ma4: 1e3m A:2-116 [39747] Other proteins in same PDB: d1e3ma1, d1e3ma2, d1e3ma3, d1e3mb1, d1e3mb2, d1e3mb3 |
PDB Entry: 1e3m (more details), 2.2 Å
SCOP Domain Sequences for d1e3ma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ma4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli} saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1e3ma4:
View in 3D Domains from other chains: (mouse over for more information) d1e3mb1, d1e3mb2, d1e3mb3, d1e3mb4 |