Lineage for d1fw6a4 (1fw6 A:1-120)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134753Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
  4. 134762Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 134763Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 134764Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 134768Species Thermus aquaticus [TaxId:271] [55274] (2 PDB entries)
  8. 134771Domain d1fw6a4: 1fw6 A:1-120 [39745]
    Other proteins in same PDB: d1fw6a1, d1fw6a2, d1fw6a3, d1fw6b1, d1fw6b2, d1fw6b3

Details for d1fw6a4

PDB Entry: 1fw6 (more details), 2.7 Å

PDB Description: crystal structure of a taq muts-dna-adp ternary complex

SCOP Domain Sequences for d1fw6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw6a4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

SCOP Domain Coordinates for d1fw6a4:

Click to download the PDB-style file with coordinates for d1fw6a4.
(The format of our PDB-style files is described here.)

Timeline for d1fw6a4: