Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) |
Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
Protein DNA repair protein MutS, domain I [55273] (2 species) |
Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries) |
Domain d1ewqa4: 1ewq A:1-120 [39743] Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa3, d1ewqb1, d1ewqb2, d1ewqb3 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOP Domain Sequences for d1ewqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus} megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
Timeline for d1ewqa4:
View in 3D Domains from other chains: (mouse over for more information) d1ewqb1, d1ewqb2, d1ewqb3, d1ewqb4 |