Lineage for d1a79c2 (1a79 C:9-82)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33569Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
  4. 33570Superfamily d.75.1: tRNA splicing endonuclease EdnA, N-terminal domain [55267] (1 family) (S)
  5. 33571Family d.75.1.1: tRNA splicing endonuclease EdnA, N-terminal domain [55268] (1 protein)
  6. 33572Protein tRNA splicing endonuclease EdnA, N-terminal domain [55269] (1 species)
  7. 33573Species Methanococcus jannaschii [TaxId:2190] [55270] (1 PDB entry)
  8. 33576Domain d1a79c2: 1a79 C:9-82 [39741]
    Other proteins in same PDB: d1a79a1, d1a79b1, d1a79c1, d1a79d1

Details for d1a79c2

PDB Entry: 1a79 (more details), 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii

SCOP Domain Sequences for d1a79c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a79c2 d.75.1.1 (C:9-82) tRNA splicing endonuclease EdnA, N-terminal domain {Methanococcus jannaschii}
kitglldgdrvivfdkngisklsarhygnvegnflslslvealylinlgwlevkykdnkp
lsfeelyeyarnve

SCOP Domain Coordinates for d1a79c2:

Click to download the PDB-style file with coordinates for d1a79c2.
(The format of our PDB-style files is described here.)

Timeline for d1a79c2: