SCOPe 2.07: Domain d1a79b2: 1a79 B:9-82

Lineage for d1a79b2 (1a79 B:9-82)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family)

5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)

6. Protein Tetrameric tRNA splicing endonuclease, N-terminal domain [55269] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [55270] (1 PDB entry)

8. Domain d1a79b2: 1a79 B:9-82 [39740]
   Other proteins in same PDB: d1a79a1, d1a79b1, d1a79c1, d1a79d1
   complexed with au, so4

Details for d1a79b2

PDB Entry: 1a79, 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii

PDB Compounds: (B:) tRNA endonuclease

SCOPe Domain Sequences for d1a79b2:

Sequence; same for both SEQRES and ATOM records:

>d1a79b2 d.75.1.1 (B:9-82) Tetrameric tRNA splicing endonuclease, N-terminal domain {Methanococcus jannaschii [TaxId: 2190]}
kitglldgdrvivfdkngisklsarhygnvegnflslslvealylinlgwlevkykdnkp
lsfeelyeyarnve

Timeline for d1a79b2:

• d1a79b2 first appeared (with stable ids) in SCOP 1.55
  
• d1a79b2 appears in SCOPe 2.06
  
• d1a79b2 appears in the current release, SCOPe 2.08