Lineage for d1a79b2 (1a79 B:9-82)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958350Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) (S)
  5. 2958351Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)
  6. 2958374Protein Tetrameric tRNA splicing endonuclease, N-terminal domain [55269] (1 species)
  7. 2958375Species Methanococcus jannaschii [TaxId:2190] [55270] (1 PDB entry)
  8. 2958377Domain d1a79b2: 1a79 B:9-82 [39740]
    Other proteins in same PDB: d1a79a1, d1a79b1, d1a79c1, d1a79d1
    complexed with au, so4

Details for d1a79b2

PDB Entry: 1a79 (more details), 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii
PDB Compounds: (B:) tRNA endonuclease

SCOPe Domain Sequences for d1a79b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a79b2 d.75.1.1 (B:9-82) Tetrameric tRNA splicing endonuclease, N-terminal domain {Methanococcus jannaschii [TaxId: 2190]}
kitglldgdrvivfdkngisklsarhygnvegnflslslvealylinlgwlevkykdnkp
lsfeelyeyarnve

SCOPe Domain Coordinates for d1a79b2:

Click to download the PDB-style file with coordinates for d1a79b2.
(The format of our PDB-style files is described here.)

Timeline for d1a79b2: