SCOP 1.67: Domain d1efwb2: 1efw B:295-414

Lineage for d1efwb2 (1efw B:295-414)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family)

5. Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein)
   has additional structures inserted in the common fold loops

6. Protein Prokaryotic AspRS, insert domain [55263] (2 species)

7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries)

8. Domain d1efwb2: 1efw B:295-414 [39738]
   Other proteins in same PDB: d1efwa1, d1efwa3, d1efwb1, d1efwb3
   protein/RNA complex; complexed with 2ma, 4su, 5mu, g7m, h2u, psu, quo

Details for d1efwb2

PDB Entry: 1efw, 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli

SCOP Domain Sequences for d1efwb2:

Sequence; same for both SEQRES and ATOM records:

>d1efwb2 d.74.4.1 (B:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk

Timeline for d1efwb2:

• d1efwb2 first appeared (with stable ids) in SCOP 1.55
  
• d1efwb2 appears in SCOP 1.65
  
• d1efwb2 appears in SCOP 1.69
  
• d1efwb2 appears in the current release, SCOPe 2.08