| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family) ![]() |
| Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein) has additional structures inserted in the common fold loops |
| Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
| Species Thermus thermophilus [TaxId:274] [55265] (3 PDB entries) |
| Domain d1efwb2: 1efw B:295-414 [39738] Other proteins in same PDB: d1efwa1, d1efwa3, d1efwb1, d1efwb3 protein/RNA complex; complexed with 2ma, 4su, 5mu, g7m, h2u, psu, quo |
PDB Entry: 1efw (more details), 3 Å
SCOP Domain Sequences for d1efwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efwb2 d.74.4.1 (B:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk
Timeline for d1efwb2: