Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.4: GAD domain-like [55261] (2 families) |
Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries) |
Domain d1g51b2: 1g51 B:1295-1414 [39736] Other proteins in same PDB: d1g51a1, d1g51a3, d1g51b1, d1g51b3 complexed with amo, amp, so4 |
PDB Entry: 1g51 (more details), 2.4 Å
SCOPe Domain Sequences for d1g51b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g51b2 d.74.4.1 (B:1295-1414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]} fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk
Timeline for d1g51b2: