| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family) ![]() |
| Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein) has additional structures inserted in the common fold loops |
| Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
| Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries) |
| Domain d1g51b2: 1g51 B:1295-1414 [39736] Other proteins in same PDB: d1g51a1, d1g51a3, d1g51b1, d1g51b3 complexed with amo, amp, so4 |
PDB Entry: 1g51 (more details), 2.4 Å
SCOP Domain Sequences for d1g51b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g51b2 d.74.4.1 (B:1295-1414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk
Timeline for d1g51b2: