SCOPe 2.05: Domain d1g51a2: 1g51 A:295-414

Lineage for d1g51a2 (1g51 A:295-414)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.4: GAD domain-like [55261] (2 families)

5. Family d.74.4.1: GAD domain [55262] (2 proteins)
   has additional structures inserted in the common fold loops

6. Protein Prokaryotic AspRS, insert domain [55263] (2 species)

7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries)

8. Domain d1g51a2: 1g51 A:295-414 [39735]
   Other proteins in same PDB: d1g51a1, d1g51a3, d1g51b1, d1g51b3
   complexed with amo, amp, so4

Details for d1g51a2

PDB Entry: 1g51, 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1g51a2:

Sequence; same for both SEQRES and ATOM records:

>d1g51a2 d.74.4.1 (A:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk

Timeline for d1g51a2:

• d1g51a2 first appeared (with stable ids) in SCOP 1.55
  
• d1g51a2 appears in SCOPe 2.04
  
• d1g51a2 appears in SCOPe 2.06
  
• d1g51a2 appears in the current release, SCOPe 2.08