Lineage for d1g51a2 (1g51 A:295-414)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031575Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1031791Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 1031792Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 1031800Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 1031808Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries)
  8. 1031811Domain d1g51a2: 1g51 A:295-414 [39735]
    Other proteins in same PDB: d1g51a1, d1g51a3, d1g51b1, d1g51b3
    complexed with amo, amp, so4

Details for d1g51a2

PDB Entry: 1g51 (more details), 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1g51a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g51a2 d.74.4.1 (A:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk

SCOPe Domain Coordinates for d1g51a2:

Click to download the PDB-style file with coordinates for d1g51a2.
(The format of our PDB-style files is described here.)

Timeline for d1g51a2: