Lineage for d1eqrb2 (1eqr B:288-420)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33483Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 33556Superfamily d.74.4: Prokaryotic AspRS, insert domain [55261] (1 family) (S)
  5. 33557Family d.74.4.1: Prokaryotic AspRS, insert domain [55262] (1 protein)
  6. 33558Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 33559Species Escherichia coli [TaxId:562] [55264] (2 PDB entries)
  8. 33562Domain d1eqrb2: 1eqr B:288-420 [39733]
    Other proteins in same PDB: d1eqra1, d1eqra3, d1eqrb1, d1eqrb3, d1eqrc1, d1eqrc3

Details for d1eqrb2

PDB Entry: 1eqr (more details), 2.7 Å

PDB Description: crystal structure of free aspartyl-trna synthetase from escherichia coli

SCOP Domain Sequences for d1eqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqrb2 d.74.4.1 (B:288-420) Prokaryotic AspRS, insert domain {Escherichia coli}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

SCOP Domain Coordinates for d1eqrb2:

Click to download the PDB-style file with coordinates for d1eqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1eqrb2: