Lineage for d1eqrb2 (1eqr B:288-420)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958316Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 2958317Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 2958325Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 2958326Species Escherichia coli [TaxId:562] [55264] (3 PDB entries)
  8. 2958331Domain d1eqrb2: 1eqr B:288-420 [39733]
    Other proteins in same PDB: d1eqra1, d1eqra3, d1eqrb1, d1eqrb3, d1eqrc1, d1eqrc3
    complexed with mg

Details for d1eqrb2

PDB Entry: 1eqr (more details), 2.7 Å

PDB Description: crystal structure of free aspartyl-trna synthetase from escherichia coli
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1eqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqrb2 d.74.4.1 (B:288-420) Prokaryotic AspRS, insert domain {Escherichia coli [TaxId: 562]}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

SCOPe Domain Coordinates for d1eqrb2:

Click to download the PDB-style file with coordinates for d1eqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1eqrb2: