Lineage for d1c0aa2 (1c0a A:288-420)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209032Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1209254Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 1209255Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 1209263Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 1209264Species Escherichia coli [TaxId:562] [55264] (3 PDB entries)
  8. 1209265Domain d1c0aa2: 1c0a A:288-420 [39731]
    Other proteins in same PDB: d1c0aa1, d1c0aa3
    protein/RNA complex; complexed with amo, amp, so4

Details for d1c0aa2

PDB Entry: 1c0a (more details), 2.4 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase : trnaasp : aspartyl-adenylate complex
PDB Compounds: (A:) aspartyl tRNA synthetase

SCOPe Domain Sequences for d1c0aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0aa2 d.74.4.1 (A:288-420) Prokaryotic AspRS, insert domain {Escherichia coli [TaxId: 562]}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

SCOPe Domain Coordinates for d1c0aa2:

Click to download the PDB-style file with coordinates for d1c0aa2.
(The format of our PDB-style files is described here.)

Timeline for d1c0aa2: