SCOP 1.55: Domain d1bdfc1: 1bdf C:1-52,C:179-235

Lineage for d1bdfc1 (1bdf C:1-52,C:179-235)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)

4. Superfamily d.74.3: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55257] (1 family)

5. Family d.74.3.1: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55258] (1 protein)

6. Protein Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55259] (1 species)

7. Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)

8. Domain d1bdfc1: 1bdf C:1-52,C:179-235 [39729]
   Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfc1

PDB Entry: 1bdf, 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfc1:

Sequence; same for both SEQRES and ATOM records:

>d1bdfc1 d.74.3.1 (C:1-52,C:179-235) Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

Timeline for d1bdfc1:

• d1bdfc1 appears in SCOP 1.57
  
• d1bdfc1 appears in the current release, SCOPe 2.08