Lineage for d1bdfc1 (1bdf C:1-52,C:179-235)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33483Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 33548Superfamily d.74.3: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55257] (1 family) (S)
  5. 33549Family d.74.3.1: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55258] (1 protein)
  6. 33550Protein Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55259] (1 species)
  7. 33551Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
  8. 33554Domain d1bdfc1: 1bdf C:1-52,C:179-235 [39729]
    Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfc1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfc1 d.74.3.1 (C:1-52,C:179-235) Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

SCOP Domain Coordinates for d1bdfc1:

Click to download the PDB-style file with coordinates for d1bdfc1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfc1: