Lineage for d7kwha_ (7kwh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969531Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2969592Domain d7kwha_: 7kwh A: [397285]
    automated match to d4mhdc_
    complexed with po4

Details for d7kwha_

PDB Entry: 7kwh (more details), 2.9 Å

PDB Description: spermidine n-acetyltransferase speg k23-y30 chimera from vibrio cholerae and hssat
PDB Compounds: (A:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d7kwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kwha_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sqltlralergdlrfihnlnkelaryeywfeepyesfdeleelynkhihdnaerrfvved
aqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylh
vavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

SCOPe Domain Coordinates for d7kwha_:

Click to download the PDB-style file with coordinates for d7kwha_.
(The format of our PDB-style files is described here.)

Timeline for d7kwha_: