Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mus musculus [TaxId:10090] [355187] (7 PDB entries) |
Domain d7koda_: 7kod A: [397282] automated match to d5up8a_ |
PDB Entry: 7kod (more details), 1.66 Å
SCOPe Domain Sequences for d7koda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7koda_ a.25.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]} psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d7koda_: