Lineage for d1bdfa1 (1bdf A:2-52,A:179-232)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913588Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1913589Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1913590Protein RNA polymerase alpha [55259] (3 species)
  7. 1913591Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
  8. 1913592Domain d1bdfa1: 1bdf A:2-52,A:179-232 [39727]
    Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfa1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain
PDB Compounds: (A:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1bdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfa1 d.74.3.1 (A:2-52,A:179-232) RNA polymerase alpha {Escherichia coli [TaxId: 562]}
qgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriayn
veaarveqrtdldklviemetngtidpeeairraatilaeqleafv

SCOPe Domain Coordinates for d1bdfa1:

Click to download the PDB-style file with coordinates for d1bdfa1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfa1: