Lineage for d1bdfa1 (1bdf A:2-52,A:179-232)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726990Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 726991Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 726992Protein RNA polymerase alpha [55259] (3 species)
  7. 726993Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
  8. 726994Domain d1bdfa1: 1bdf A:2-52,A:179-232 [39727]
    Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfa1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain
PDB Compounds: (A:) RNA polymerase alpha subunit

SCOP Domain Sequences for d1bdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfa1 d.74.3.1 (A:2-52,A:179-232) RNA polymerase alpha {Escherichia coli [TaxId: 562]}
qgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriayn
veaarveqrtdldklviemetngtidpeeairraatilaeqleafv

SCOP Domain Coordinates for d1bdfa1:

Click to download the PDB-style file with coordinates for d1bdfa1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfa1: