Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Brucella melitensis [TaxId:224914] [397254] (1 PDB entry) |
Domain d6ph2c_: 6ph2 C: [397256] automated match to d5a8bb_ complexed with fmn; mutant |
PDB Entry: 6ph2 (more details), 2.34 Å
SCOPe Domain Sequences for d6ph2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ph2c_ d.110.3.0 (C:) automated matches {Brucella melitensis [TaxId: 224914]} atdpfraaveftlmpmlitnphlpdnpivfanpaflkltgyeadevmgrnsrflqghgtd pahvraiksaiaaekpididiinykksgeafwnrlhispvhnangrlqhfvssqldvtle lsrl
Timeline for d6ph2c_: