Lineage for d6ph2c_ (6ph2 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970638Species Brucella melitensis [TaxId:224914] [397254] (1 PDB entry)
  8. 2970641Domain d6ph2c_: 6ph2 C: [397256]
    automated match to d5a8bb_
    complexed with fmn; mutant

Details for d6ph2c_

PDB Entry: 6ph2 (more details), 2.34 Å

PDB Description: complete lov domain from the lov-hk sensory protein from brucella abortus (mutant c69s, construct 15-155)
PDB Compounds: (C:) Blue-light-activated histidine kinase

SCOPe Domain Sequences for d6ph2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ph2c_ d.110.3.0 (C:) automated matches {Brucella melitensis [TaxId: 224914]}
atdpfraaveftlmpmlitnphlpdnpivfanpaflkltgyeadevmgrnsrflqghgtd
pahvraiksaiaaekpididiinykksgeafwnrlhispvhnangrlqhfvssqldvtle
lsrl

SCOPe Domain Coordinates for d6ph2c_:

Click to download the PDB-style file with coordinates for d6ph2c_.
(The format of our PDB-style files is described here.)

Timeline for d6ph2c_: