SCOPe 2.08: Domain d6lkya_: 6lky A:

Lineage for d6lkya_ (6lky A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [397229] (1 PDB entry)

8. Domain d6lkya_: 6lky A: [397230]
   automated match to d4yb4a_
   complexed with ace, act, cit, nad

Details for d6lkya_

PDB Entry: 6lky, 2.2 Å

PDB Description: crystal structure of isocitrate dehydrogenase from methylococcus capsulatus

PDB Compounds: (A:) Putative isocitrate dehydrogenase, NAD-dependent

SCOPe Domain Sequences for d6lkya_:

Sequence; same for both SEQRES and ATOM records:

>d6lkya_ c.77.1.0 (A:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
mhkitlipgdgigpsivdaavkvieatgvqvqwdtqsagmaavekfgtplpdatldsira
nricfkgplttpvgggyrsvnvtlrqalnlyanvrpaisfegtdtafsdvnlvtvrente
glyagiehfikvdeekiaaesiavvtrkgseriiryafdyarrarrkkvtlvhkanilkc
tsglfleigreiakeypdiefddrivdacsmqmvmqpqrfdvlvttnlfgdilsdlaagl
igglgltaganigtdaalfeavhgsapdiadkgianptamimagammlehigepdaarri
eravreviedgrsvtpdlakdspcgtaqmaeaivervrq

Timeline for d6lkya_:

• d6lkya_ first appeared in SCOPe 2.07