Lineage for d1b4ac2 (1b4a C:79-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958076Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 2958077Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 2958078Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)
  8. 2958084Domain d1b4ac2: 1b4a C:79-149 [39723]
    Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ac2

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus
PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d1b4ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ac2 d.74.2.1 (C:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

SCOPe Domain Coordinates for d1b4ac2:

Click to download the PDB-style file with coordinates for d1b4ac2.
(The format of our PDB-style files is described here.)

Timeline for d1b4ac2: