SCOPe 2.07: Domain d6lrwa_: 6lrw A:

Lineage for d6lrwa_ (6lrw A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Penaeus japonicus [TaxId:27405] [379454] (14 PDB entries)

8. Domain d6lrwa_: 6lrw A: [397228]
   automated match to d3a9qe_
   mutant

Details for d6lrwa_

PDB Entry: 6lrw, 2.4 Å

PDB Description: marsupenaeus japonicus ferritin mutant(t158h) ph 7.0

PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6lrwa_:

Sequence; same for both SEQRES and ATOM records:

>d6lrwa_ a.25.1.0 (A:) automated matches {Penaeus japonicus [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragphglgeymfdkeln

Timeline for d6lrwa_:

• d6lrwa_ is new in SCOPe 2.07-stable
  
• d6lrwa_ appears in the current release, SCOPe 2.08