Lineage for d6lz2c_ (6lz2 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941009Species Galaxea fascicularis [TaxId:46745] [357997] (2 PDB entries)
  8. 2941015Domain d6lz2c_: 6lz2 C: [397209]
    Other proteins in same PDB: d6lz2b_, d6lz2d1, d6lz2d2
    automated match to d2c9ia_
    complexed with act, crq, gol, na, trs

Details for d6lz2c_

PDB Entry: 6lz2 (more details), 2.03 Å

PDB Description: crystal structure of a thermostable green fluorescent protein (tgp) with a synthetic nanobody (sb44)
PDB Compounds: (C:) Thermostable green fluorescent protein

SCOPe Domain Sequences for d6lz2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lz2c_ d.22.1.0 (C:) automated matches {Galaxea fascicularis [TaxId: 46745]}
asvikpemkiklrmegavnghkfviegegigkpyegtqtldltveegaplpfsydiltpa
fqygnraftkypedipdyfkqafpegyswersmtyedqgiciatsditmegdcffyeirf
dgtnfppngpvmqkktlkwepstekmyvedgvlkgdvemallleggghyrcdfkttykak
kdvrlpdahevdhrieilshdkdynkvrlyehaearysgg

SCOPe Domain Coordinates for d6lz2c_:

Click to download the PDB-style file with coordinates for d6lz2c_.
(The format of our PDB-style files is described here.)

Timeline for d6lz2c_: