SCOPe 2.08: Domain d6kwfa1: 6kwf A:2-190

Lineage for d6kwfa1 (6kwf A:2-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei [TaxId:1344414] [383615] (12 PDB entries)

8. Domain d6kwfa1: 6kwf A:2-190 [397164]
   Other proteins in same PDB: d6kwfa2
   automated match to d3aksa_
   complexed with gol, iod, xyp

Details for d6kwfa1

PDB Entry: 6kwf, 1.22 Å

PDB Description: crystal structure analysis of endo-beta-1,4-xylanase ii complexed with xylotriose

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d6kwfa1:

Sequence; same for both SEQRES and ATOM records:

>d6kwfa1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei [TaxId: 1344414]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgdfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d6kwfa1:

• d6kwfa1 first appeared in SCOPe 2.07