Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries) |
Domain d7kk5c2: 7kk5 C:797-1010 [397131] Other proteins in same PDB: d7kk5a1, d7kk5b1, d7kk5c1, d7kk5c3, d7kk5d1 automated match to d4hhyd2 complexed with 3jd, so4 |
PDB Entry: 7kk5 (more details), 1.7 Å
SCOPe Domain Sequences for d7kk5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kk5c2 d.166.1.0 (C:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfk
Timeline for d7kk5c2: