Lineage for d7kk5c2 (7kk5 C:797-1010)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606733Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)
  8. 2606741Domain d7kk5c2: 7kk5 C:797-1010 [397131]
    Other proteins in same PDB: d7kk5a1, d7kk5b1, d7kk5c1, d7kk5c3, d7kk5d1
    automated match to d4hhyd2
    complexed with 3jd, so4

Details for d7kk5c2

PDB Entry: 7kk5 (more details), 1.7 Å

PDB Description: structure of the catalytic domain of parp1 in complex with niraparib
PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7kk5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kk5c2 d.166.1.0 (C:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d7kk5c2:

Click to download the PDB-style file with coordinates for d7kk5c2.
(The format of our PDB-style files is described here.)

Timeline for d7kk5c2: