SCOPe 2.07: Domain d7kk5d2: 7kk5 D:797-1010

Lineage for d7kk5d2 (7kk5 D:797-1010)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d7kk5d2: 7kk5 D:797-1010 [397122]
   Other proteins in same PDB: d7kk5a1, d7kk5b1, d7kk5c1, d7kk5c3, d7kk5d1
   automated match to d4hhyd2
   complexed with 3jd, so4

Details for d7kk5d2

PDB Entry: 7kk5, 1.7 Å

PDB Description: structure of the catalytic domain of parp1 in complex with niraparib

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7kk5d2:

Sequence; same for both SEQRES and ATOM records:

>d7kk5d2 d.166.1.0 (D:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

Timeline for d7kk5d2:

• d7kk5d2 is new in SCOPe 2.07-stable
  
• d7kk5d2 appears in the current release, SCOPe 2.08