SCOPe 2.07: Domain d7kk3a1: 7kk3 A:662-796

Lineage for d7kk3a1 (7kk3 A:662-796)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)

8. Domain d7kk3a1: 7kk3 A:662-796 [397103]
   Other proteins in same PDB: d7kk3a2, d7kk3b2, d7kk3c2, d7kk3c3, d7kk3d2
   automated match to d4hhyd1
   complexed with 2yq

Details for d7kk3a1

PDB Entry: 7kk3, 2.06 Å

PDB Description: structure of the catalytic domain of parp1 in complex with talazoparib

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7kk3a1:

Sequence, based on SEQRES records:

>d7kk3a1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records):

>d7kk3a1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qdsqildlsnrfytliphdfkppnnadsvqakvemldnlldievaysllrgskdpidvny
ek

Timeline for d7kk3a1:

• d7kk3a1 is new in SCOPe 2.07-stable
  
• d7kk3a1 appears in the current release, SCOPe 2.08