Lineage for d1xxab_ (1xxa B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913525Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1913526Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 1913527Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 1913548Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)
  8. 1913550Domain d1xxab_: 1xxa B: [39701]
    protein/DNA complex; complexed with arg, pb

Details for d1xxab_

PDB Entry: 1xxa (more details), 2.2 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex; pb derivative
PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d1xxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxab_ d.74.2.1 (B:) C-terminal domain of arginine repressor {Escherichia coli [TaxId: 562]}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

SCOPe Domain Coordinates for d1xxab_:

Click to download the PDB-style file with coordinates for d1xxab_.
(The format of our PDB-style files is described here.)

Timeline for d1xxab_: