SCOPe 2.07: Domain d7d8jb_: 7d8j B:

Lineage for d7d8jb_ (7d8j B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:681288] [356122] (3 PDB entries)

8. Domain d7d8jb_: 7d8j B: [397006]
   automated match to d2vw9a_
   complexed with urf

Details for d7d8jb_

PDB Entry: 7d8j, 2.88 Å

PDB Description: s. aureus ssbb with 5-fu

PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d7d8jb_:

Sequence, based on SEQRES records:

>d7d8jb_ b.40.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflep

Sequence, based on observed residues (ATOM records):

>d7d8jb_ b.40.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyvfvtevvadsvqflep

Timeline for d7d8jb_:

• d7d8jb_ is new in SCOPe 2.07-stable
  
• d7d8jb_ appears in the current release, SCOPe 2.08